Lineage for d6fxla1 (6fxl A:1-153)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. Protein automated matches [191196] (11 species)
    not a true protein
  7. Species Trypanosoma cruzi [TaxId:353153] [189510] (5 PDB entries)
  8. Domain d6fxla1: 6fxl A:1-153 [369047]
    Other proteins in same PDB: d6fxla2, d6fxlc2, d6fxld2
    automated match to d3k7pa_
    complexed with po4

Details for d6fxla1

PDB Entry: 6fxl (more details), 1.96 Å

PDB Description: structure of trypanosoma cruzi type b ribose 5-phosphate isomerase (tcrpib)
PDB Compounds: (A:) Ribose 5-phosphate isomerase, putative

SCOPe Domain Sequences for d6fxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxla1 c.121.1.0 (A:1-153) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
evefgvlacgsgigmsiaankvpgvraalcydhytaaisrihndanivcvgerttgvevi
reiiitflqtpfsgeerharriekiraieasha

SCOPe Domain Coordinates for d6fxla1 are not available.

Timeline for d6fxla1:

Domains from same chain:
(mouse over for more information)
d6fxla2
Domains from other chains:
(mouse over for more information)
d6fxlb_, d6fxlc1, d6fxlc2, d6fxld1, d6fxld2