SCOPe 2.07: Domain d6fxsb_: 6fxs B:

Lineage for d6fxsb_ (6fxs B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (11 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:185431] [369044] (1 PDB entry)

8. Domain d6fxsb_: 6fxs B: [369045]
   automated match to d3k7sa_
   complexed with so4

Details for d6fxsb_

PDB Entry: 6fxs, 2.01 Å

PDB Description: structure of trypanosoma brucei type b ribose 5-phosphate isomerase

PDB Compounds: (B:) Ribose 5-phosphate isomerase, putative

SCOPe Domain Sequences for d6fxsb_:

Sequence; same for both SEQRES and ATOM records:

>d6fxsb_ c.121.1.0 (B:) automated matches {Trypanosoma brucei [TaxId: 185431]}
trkvaigadhigfpihesivryvreageefepvyigphslervdypdyalnvarmvarge
advgilvcgsgigmsiaankvpgiraalcfdhytavmarqhndanvvclgerttgpavlr
eiimtflqtpysgedrhtqrlekikaaes

Timeline for d6fxsb_:

• d6fxsb_ is new in SCOPe 2.07-stable
  
• d6fxsb_ appears in the current release, SCOPe 2.08