Lineage for d6fxsb_ (6fxs B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922082Species Trypanosoma brucei [TaxId:185431] [369044] (1 PDB entry)
  8. 2922084Domain d6fxsb_: 6fxs B: [369045]
    automated match to d3k7sa_
    complexed with so4

Details for d6fxsb_

PDB Entry: 6fxs (more details), 2.01 Å

PDB Description: structure of trypanosoma brucei type b ribose 5-phosphate isomerase
PDB Compounds: (B:) Ribose 5-phosphate isomerase, putative

SCOPe Domain Sequences for d6fxsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxsb_ c.121.1.0 (B:) automated matches {Trypanosoma brucei [TaxId: 185431]}
trkvaigadhigfpihesivryvreageefepvyigphslervdypdyalnvarmvarge
advgilvcgsgigmsiaankvpgiraalcfdhytavmarqhndanvvclgerttgpavlr
eiimtflqtpysgedrhtqrlekikaaes

SCOPe Domain Coordinates for d6fxsb_:

Click to download the PDB-style file with coordinates for d6fxsb_.
(The format of our PDB-style files is described here.)

Timeline for d6fxsb_: