Lineage for d6e4xy2 (6e4x Y:103-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (17 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 3068981Domain d6e4xy2: 6e4x Y:103-208 [369043]
    Other proteins in same PDB: d6e4xb_, d6e4xy1
    automated match to d1dn0a2
    complexed with bma, fuc, gol, man, nag

Details for d6e4xy2

PDB Entry: 6e4x (more details), 2.25 Å

PDB Description: human antibody s5v2-29 in complex with influenza hemagglutinin a/texas/50/2012 (h3n2)
PDB Compounds: (Y:) S5V2-29 light chain

SCOPe Domain Sequences for d6e4xy2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e4xy2 b.1.1.2 (Y:103-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6e4xy2:

Click to download the PDB-style file with coordinates for d6e4xy2.
(The format of our PDB-style files is described here.)

Timeline for d6e4xy2:

  • d6e4xy2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6e4xy1
View in 3D
Domains from other chains:
(mouse over for more information)
d6e4xb_