Lineage for d6dgpb_ (6dgp B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2341917Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2341918Species Human (Homo sapiens) [TaxId:9606] [48525] (167 PDB entries)
    Uniprot P37231 232-505
  8. 2342214Domain d6dgpb_: 6dgp B: [369038]
    automated match to d3prga_

Details for d6dgpb_

PDB Entry: 6dgp (more details), 3.1 Å

PDB Description: crystal structure of human ppargamma ligand binding domain in complex with trap220 coactivator peptide
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6dgpb_:

Sequence, based on SEQRES records: (download)

>d6dgpb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d6dgpb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfev
airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
ktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d6dgpb_:

Click to download the PDB-style file with coordinates for d6dgpb_.
(The format of our PDB-style files is described here.)

Timeline for d6dgpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6dgpa_