SCOP 1.71: Domain d1dyc__: 1dyc -

Lineage for d1dyc__ (1dyc -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
   many mutant structures

8. Domain d1dyc__: 1dyc - [36903]
   complexed with cl, seo; mutant

Details for d1dyc__

PDB Entry: 1dyc, 2.1 Å

PDB Description: determination of alpha-helix propensity within the context of a folded protein: sites 44 and 131 in bacteriophage t4 lysozyme

SCOP Domain Sequences for d1dyc__:

Sequence; same for both SEQRES and ATOM records:

>d1dyc__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaainlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1dyc__:

• d1dyc__ first appeared (with stable ids) in SCOP 1.55
  
• d1dyc__ appears in SCOP 1.69
  
• d1dyc__ is called d1dyca_ in SCOP 1.73
  
• d1dyc__ appears in the current release, SCOPe 2.08, called d1dyca_