Lineage for d6oqqd_ (6oqq D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2319950Protein Calmodulin [47516] (14 species)
  7. 3068869Species Saccharomyces cerevisiae [TaxId:559292] [368931] (1 PDB entry)
  8. 3068961Domain d6oqqd_: 6oqq D: [369023]
    automated match to d1lkja_
    complexed with amp, ca, edo, mg, na, pop

Details for d6oqqd_

PDB Entry: 6oqq (more details), 2.1 Å

PDB Description: legionella pneumophila sidj/saccharomyces cerevisiae calmodulin complex
PDB Compounds: (D:) calmodulin

SCOPe Domain Sequences for d6oqqd_:

Sequence, based on SEQRES records: (download)

>d6oqqd_ a.39.1.5 (D:) Calmodulin {Saccharomyces cerevisiae [TaxId: 559292]}
lteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgnhqi
efseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdaevdd
mlrevsdgsgeiniqqfaalls

Sequence, based on observed residues (ATOM records): (download)

>d6oqqd_ a.39.1.5 (D:) Calmodulin {Saccharomyces cerevisiae [TaxId: 559292]}
lteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgnhqi
efseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdaevdd
mniqqfaalls

SCOPe Domain Coordinates for d6oqqd_:

Click to download the PDB-style file with coordinates for d6oqqd_.
(The format of our PDB-style files is described here.)

Timeline for d6oqqd_: