SCOPe 2.07: Domain d6otva2: 6otv A:174-356

Lineage for d6otva2 (6otv A:174-356)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [368985] (1 PDB entry)

8. Domain d6otva2: 6otv A:174-356 [369012]
   automated match to d3g7ka2
   complexed with act, edo, po4

Details for d6otva2

PDB Entry: 6otv, 2.4 Å

PDB Description: crystal structure of putative isomerase ec2056

PDB Compounds: (A:) Putative isomerase YbhH

SCOPe Domain Sequences for d6otva2:

Sequence; same for both SEQRES and ATOM records:

>d6otva2 d.21.1.0 (A:174-356) automated matches {Escherichia coli [TaxId: 83333]}
gtktgkvfptdnqidyfddvpvtcidmampvviipaeylgktgyelpaeldadkallari
esirlqagkamglgdvsnmvipkpvlispaqkggainvryfmphschralaitgaiaiss
scalegtvtrqivpsvgygniniehpsgaldvhlsnegqdattlrasvirttrkifsgev
ylp

Timeline for d6otva2:

• d6otva2 is new in SCOPe 2.07-stable
  
• d6otva2 appears in the current release, SCOPe 2.08