Lineage for d5zwkd_ (5zwk D:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. Protein automated matches [190281] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries)
  8. Domain d5zwkd_: 5zwk D: [368997]
    automated match to d1fsaa_
    complexed with amp, fbp, mg

Details for d5zwkd_

PDB Entry: 5zwk (more details), 2.1 Å

PDB Description: crystal structure of human liver fructose-1,6-bisphoaphatase complex with fructose-1,6-bisphophate and amp
PDB Compounds: (D:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d5zwkd_:

Sequence, based on SEQRES records: (download)

>d5zwkd_ e.7.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagstnvtgd
qvkkldvlsndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidc
lvsvgtifgiyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldp
aigefilvdkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldvipt
dihqrapvilgspddvleflkvyekhs

Sequence, based on observed residues (ATOM records): (download)

>d5zwkd_ e.7.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagvkkldvl
sndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidclvsvgtif
giyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldpaigefilv
dkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsmvadvhrtl
vyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldviptdihqrapv
ilgspddvleflkvyekhs

SCOPe Domain Coordinates for d5zwkd_ are not available.

Timeline for d5zwkd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zwka_, d5zwkb_, d5zwkc_