Lineage for d5zvpa_ (5zvp A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (34 species)
    not a true protein
  7. 3068931Species Aspergillus fumigatus [TaxId:330879] [368993] (1 PDB entry)
  8. 3068932Domain d5zvpa_: 5zvp A: [368994]
    automated match to d6bcbf_
    complexed with gdp, mg, so4

Details for d5zvpa_

PDB Entry: 5zvp (more details), 1.42 Å

PDB Description: aspergillus fumigatus rho1 f25n
PDB Compounds: (A:) Rho GTPase Rho1

SCOPe Domain Sequences for d5zvpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zvpa_ c.37.1.8 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
maeirrklvivgdgacgktcllivnskgtfpevyvptvfenyvadvevdgkhvelalwdt
agqedydrlrplsypdshvilicfaidspdsldnvqekwisevlhfcqglpiilvgckkd
lrhdpktieelhktsqkpvtpeqgeevrkkigaykylecsartnegvrevfeaatraall
t

SCOPe Domain Coordinates for d5zvpa_:

Click to download the PDB-style file with coordinates for d5zvpa_.
(The format of our PDB-style files is described here.)

Timeline for d5zvpa_:

  • d5zvpa_ is new in SCOPe 2.07-stable