Lineage for d6q9wb_ (6q9w B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712548Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 2712549Protein automated matches [190960] (1 species)
    not a true protein
  7. 2712550Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)
  8. 2712562Domain d6q9wb_: 6q9w B: [368960]
    automated match to d5trfd_
    complexed with hrt, o4b, so4

Details for d6q9wb_

PDB Entry: 6q9w (more details), 1.55 Å

PDB Description: x-ray structure of compound 15 bound to hdmx: structural states of hdm2 and hdmx: x-ray elucidation of adaptations and binding interactions for different chemical compound classes
PDB Compounds: (B:) Protein Mdm4

SCOPe Domain Sequences for d6q9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q9wb_ a.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
lgrqsfsvkdpsplydmlrknlvt

SCOPe Domain Coordinates for d6q9wb_:

Click to download the PDB-style file with coordinates for d6q9wb_.
(The format of our PDB-style files is described here.)

Timeline for d6q9wb_: