SCOPe 2.07: Domain d6mzkc2: 6mzk C:336-500

Lineage for d6mzkc2 (6mzk C:336-500)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus [TaxId:1206674] [368914] (1 PDB entry)

8. Domain d6mzkc2: 6mzk C:336-500 [368950]
   Other proteins in same PDB: d6mzka1, d6mzkb1, d6mzkc1
   automated match to d5k9kf2
   complexed with bma, nag

Details for d6mzkc2

PDB Entry: 6mzk, 2.5 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/pennsylvania/14/2010 (h3n2)

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6mzkc2:

Sequence; same for both SEQRES and ATOM records:

>d6mzkc2 h.3.1.0 (C:336-500) automated matches {Influenza a virus [TaxId: 1206674]}
agfiengwegmvdgwygyrhqnsegtgqaadlkstqaainqitgklnrvikktnekfhqi
ekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfertrkql
renaedmgngcfkiyhkcdntcigsirngtydhavyrdealnnrf

Timeline for d6mzkc2:

• d6mzkc2 is new in SCOPe 2.07-stable
  
• d6mzkc2 appears in the current release, SCOPe 2.08