SCOPe 2.08: Domain d6myma1: 6mym A:8-324

Lineage for d6myma1 (6mym A:8-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId:382825] [368906] (1 PDB entry)

8. Domain d6myma1: 6mym A:8-324 [368946]
   Other proteins in same PDB: d6myma2, d6mymb2, d6mymc2
   automated match to d4we4a_
   complexed with bma, nag

Details for d6myma1

PDB Entry: 6mym, 2.45 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/phillipines/2/1982 (h3n2)

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6myma1:

Sequence; same for both SEQRES and ATOM records:

>d6myma1 b.19.1.2 (A:8-324) Hemagglutinin {Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId: 382825]}
nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
tgvtqsggsytckrgsnnsffsrlnwlyeseskypvlnvtmpnngkfdklyiwgihhpst
dkeqtnlyirasgrvtvstkrsqqtvipnigsrpwvrglssrisiywtivkpgdillins
tgnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpr
yvkqntlklatgmrnvp

Timeline for d6myma1:

• d6myma1 first appeared in SCOPe 2.07