SCOPe 2.08: Domain d6q9yb_: 6q9y B:

Lineage for d6q9yb_ (6q9y B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.0: automated matches [191556] (1 protein)
   not a true family

6. Protein automated matches [190960] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)

8. Domain d6q9yb_: 6q9y B: [368944]
   automated match to d5trfd_
   complexed with hrq

Details for d6q9yb_

PDB Entry: 6q9y, 1.2 Å

PDB Description: hdmx (14-111; c17s) complexed with compound 16 at 1.20a; structural states of hdm2 and hdmx: x-ray elucidation of adaptations and binding interactions for different chemical compound classes

PDB Compounds: (B:) Protein Mdm4

SCOPe Domain Sequences for d6q9yb_:

Sequence; same for both SEQRES and ATOM records:

>d6q9yb_ a.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtla

Timeline for d6q9yb_:

• d6q9yb_ first appeared in SCOPe 2.07