Lineage for d1d2ya_ (1d2y A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76503Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 76504Protein Phage T4 lysozyme [53982] (1 species)
  7. 76505Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries)
  8. 76791Domain d1d2ya_: 1d2y A: [36894]

Details for d1d2ya_

PDB Entry: 1d2y (more details), 2.06 Å

PDB Description: n-terminal domain core methionine mutation

SCOP Domain Sequences for d1d2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ya_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkamgrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d1d2ya_:

Click to download the PDB-style file with coordinates for d1d2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ya_: