Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId:506347] [368938] (1 PDB entry) |
Domain d6osrb2: 6osr B:330-486 [368939] Other proteins in same PDB: d6osra1, d6osrb1, d6osrb3, d6osrc1, d6osrd1, d6osre1, d6osrf1 automated match to d4wsrd2 complexed with bma, edo, k, man, na, nag |
PDB Entry: 6osr (more details), 2.55 Å
SCOPe Domain Sequences for d6osrb2:
Sequence, based on SEQRES records: (download)
>d6osrb2 h.3.1.0 (B:330-486) automated matches {Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId: 506347]} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn tqftavgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye kvkiqlknnakeigngcfefyhkcdnecmesvrngty
>d6osrb2 h.3.1.0 (B:330-486) automated matches {Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId: 506347]} glfgaiagfieggwtgmidgwygyhhqneqyaadqkstqnaingitnkvnsviekmntqf tavgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlyekvk iqlknnakeigngcfefyhkcdnecmesvrngty
Timeline for d6osrb2: