SCOPe 2.07: Domain d6gr8a1: 6gr8 A:36-303

Lineage for d6gr8a1 (6gr8 A:36-303)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d6gr8a1: 6gr8 A:36-303 [368927]
   Other proteins in same PDB: d6gr8a2
   automated match to d5k3yb_
   complexed with f8z

Details for d6gr8a1

PDB Entry: 6gr8, 1.75 Å

PDB Description: human aurkc incenp complex bound to brd-7880

PDB Compounds: (A:) Aurora kinase C

SCOPe Domain Sequences for d6gr8a1:

Sequence; same for both SEQRES and ATOM records:

>d6gr8a1 d.144.1.7 (A:36-303) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrltvddfeigrplgkgkfgnvylarlkeshfivalkvlfksqiekeglehqlrreieiq
ahlqhpnilrlynyfhdarrvylileyaprgelykelqksdkldeqrtatiieeladalt
ychdkkvihrdikpenlllgfrgevkiadfgwsvhtpslrrktmcgtldylppemiegrt
ydekvdlwcigvlcyellvgyppfesashsetyrrilkvdvrfplsmplgardlisrllr
yqplerlplaqilkhpwvqahsrrvlpp

Timeline for d6gr8a1:

• d6gr8a1 is new in SCOPe 2.07-stable
  
• d6gr8a1 appears in the current release, SCOPe 2.08