Lineage for d6n08b2 (6n08 B:334-502)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 3068816Species Influenza a virus (a/netherlands/209/1980(h3n2)) [TaxId:1086943] [368878] (1 PDB entry)
  8. 3068861Domain d6n08b2: 6n08 B:334-502 [368923]
    Other proteins in same PDB: d6n08a1, d6n08b1, d6n08c1
    automated match to d5k9kf2
    complexed with bma, nag

Details for d6n08b2

PDB Entry: 6n08 (more details), 1.92 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/netherlands/209/1980 (h3n2)
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6n08b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n08b2 h.3.1.0 (B:334-502) automated matches {Influenza a virus (a/netherlands/209/1980(h3n2)) [TaxId: 1086943]}
aiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekfh
qiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrr
qlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6n08b2:

Click to download the PDB-style file with coordinates for d6n08b2.
(The format of our PDB-style files is described here.)

Timeline for d6n08b2: