Lineage for d6mymc2 (6mym C:333-502)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 3068846Species Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId:382825] [368908] (1 PDB entry)
  8. 3068847Domain d6mymc2: 6mym C:333-502 [368909]
    Other proteins in same PDB: d6myma1, d6mymb1, d6mymc1
    automated match to d1ha0a2
    complexed with bma, nag

Details for d6mymc2

PDB Entry: 6mym (more details), 2.45 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/phillipines/2/1982 (h3n2)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6mymc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mymc2 h.3.1.0 (C:333-502) automated matches {Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId: 382825]}
gaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
kqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6mymc2:

Click to download the PDB-style file with coordinates for d6mymc2.
(The format of our PDB-style files is described here.)

Timeline for d6mymc2: