SCOPe 2.08: Domain d6o9zm1: 6o9z M:5-88

Lineage for d6o9zm1 (6o9z M:5-88)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)

8. Domain d6o9zm1: 6o9z M:5-88 [368904]
   Other proteins in same PDB: d6o9zl2, d6o9zm2
   automated match to d1kl9a2

Details for d6o9zm1

PDB Entry: 6o9z, 3.03 Å

PDB Description: electron cryo-microscopy of the eukaryotic translation initiation factor 2b bound to eukaryotic translation initiation factor 2 from homo sapiens

PDB Compounds: (M:) Eukaryotic translation initiation factor 2 subunit 1

SCOPe Domain Sequences for d6o9zm1:

Sequence; same for both SEQRES and ATOM records:

>d6o9zm1 b.40.4.0 (M:5-88) automated matches {Human (Homo sapiens) [TaxId: 9606]}
crfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselsrrrirsinkliri
grnecvvvirvdkekgyidlskrr

Timeline for d6o9zm1:

• d6o9zm1 first appeared in SCOPe 2.07