SCOPe 2.07: Domain d6n08a2: 6n08 A:334-502

Lineage for d6n08a2 (6n08 A:334-502)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus (a/netherlands/209/1980(h3n2)) [TaxId:1086943] [368878] (1 PDB entry)

8. Domain d6n08a2: 6n08 A:334-502 [368896]
   Other proteins in same PDB: d6n08a1, d6n08b1, d6n08c1
   automated match to d5k9kf2
   complexed with bma, nag

Details for d6n08a2

PDB Entry: 6n08, 1.92 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/netherlands/209/1980 (h3n2)

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6n08a2:

Sequence; same for both SEQRES and ATOM records:

>d6n08a2 h.3.1.0 (A:334-502) automated matches {Influenza a virus (a/netherlands/209/1980(h3n2)) [TaxId: 1086943]}
aiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekfh
qiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrr
qlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

Timeline for d6n08a2:

• d6n08a2 is new in SCOPe 2.07-stable
  
• d6n08a2 appears in the current release, SCOPe 2.08