SCOPe 2.08: Domain d6jepl1: 6jep L:1-114

Lineage for d6jepl1 (6jep L:1-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6jepl1: 6jep L:1-114 [368884]
   Other proteins in same PDB: d6jepe_, d6jepf_
   automated match to d6azzb1

Details for d6jepl1

PDB Entry: 6jep, 2.32 Å

PDB Description: structure of a neutralizing antibody bound to the zika envelope protein domain iii

PDB Compounds: (L:) light chain of Fab ZK2B10

SCOPe Domain Sequences for d6jepl1:

Sequence; same for both SEQRES and ATOM records:

>d6jepl1 b.1.1.0 (L:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsasgtpgqrvtiscsgsssnignnyvhwyqqlpgsapklliyrnnqrpsgvp
drfsgsksgtsgslaisglrsedeadyycaswddslsghwvfgggtkvtvlgqp

Timeline for d6jepl1:

• d6jepl1 first appeared in SCOPe 2.07