SCOPe 2.08: Domain d6mxua1: 6mxu A:9-325

Lineage for d6mxua1 (6mxu A:9-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza a virus (a/texas/1/1977(h3n2)) [TaxId:444318] [368880] (1 PDB entry)

8. Domain d6mxua1: 6mxu A:9-325 [368881]
   Other proteins in same PDB: d6mxua2, d6mxub2, d6mxuc2
   automated match to d5k9kf1
   complexed with nag

Details for d6mxua1

PDB Entry: 6mxu, 1.85 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/texas/1/1977 (h3n2)

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6mxua1:

Sequence; same for both SEQRES and ATOM records:

>d6mxua1 b.19.1.2 (A:9-325) Hemagglutinin {Influenza a virus (a/texas/1/1977(h3n2)) [TaxId: 444318]}
statlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlid
allgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwt
gvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpstd
keqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillinsn
gnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpe

Timeline for d6mxua1:

• d6mxua1 first appeared in SCOPe 2.07