Lineage for d6ilke3 (6ilk E:191-253)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034310Family g.18.1.0: automated matches [254264] (1 protein)
    not a true family
  6. 3034311Protein automated matches [254611] (1 species)
    not a true protein
  7. 3034312Species Human (Homo sapiens) [TaxId:9606] [255500] (8 PDB entries)
  8. 3034332Domain d6ilke3: 6ilk E:191-253 [368865]
    Other proteins in same PDB: d6ilka_, d6ilkc_
    automated match to d1nwva2
    complexed with sph

Details for d6ilke3

PDB Entry: 6ilk (more details), 3 Å

PDB Description: cryo-em structure of echovirus 6 complexed with its attachment receptor cd55 at ph 7.4
PDB Compounds: (E:) complement decay-accelerating factor

SCOPe Domain Sequences for d6ilke3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ilke3 g.18.1.0 (E:191-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

SCOPe Domain Coordinates for d6ilke3:

Click to download the PDB-style file with coordinates for d6ilke3.
(The format of our PDB-style files is described here.)

Timeline for d6ilke3: