SCOPe 2.07: Domain d6ilka_: 6ilk A:

Lineage for d6ilka_ (6ilk A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (25 species)
   not a true protein

7. Species Echovirus e6 [TaxId:12062] [368839] (2 PDB entries)

8. Domain d6ilka_: 6ilk A: [368840]
   Other proteins in same PDB: d6ilke1, d6ilke2, d6ilke3
   automated match to d4gb31_
   complexed with sph

Details for d6ilka_

PDB Entry: 6ilk, 3 Å

PDB Description: cryo-em structure of echovirus 6 complexed with its attachment receptor cd55 at ph 7.4

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d6ilka_:

Sequence; same for both SEQRES and ATOM records:

>d6ilka_ b.121.4.1 (A:) automated matches {Echovirus e6 [TaxId: 12062]}
vvrvadtmpsgpsnsesipaltaaetghtsqvvpsdtiqtrhvrnfhvrsessvenflsr
sacvyiveyktrddtpdkmydswvintrqvaqlrrklefftyvrfdvevtfvitsvqdds
trqntdtpalthqimyvppggpipqavddynwqtstnpsvfwtegnapprmsipfmsvgn
aysnfydgwshfsqtgvygfntlnnmgklyfrhvndktispitskvriyfkpkhvkawvp
rpprlceythkdnvdfepkgvttsrtqltisnsthven

Timeline for d6ilka_:

• d6ilka_ is new in SCOPe 2.07-stable
  
• d6ilka_ appears in the current release, SCOPe 2.08