![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (87 species) not a true protein |
![]() | Species Sphinx1.76-related dna [TaxId:1515702] [368832] (1 PDB entry) |
![]() | Domain d6h24a_: 6h24 A: [368837] automated match to d1hkqa_ |
PDB Entry: 6h24 (more details), 1.53 Å
SCOPe Domain Sequences for d6h24a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h24a_ a.4.5.0 (A:) automated matches {Sphinx1.76-related dna [TaxId: 1515702]} sdlivkdnalmnasynlalveqrlillaiiearetgkginandpltvhassyinqfnver htayqalkdackdlfarqfsyqekrergrinitsrwvsqigymddtatveiifapavvpl itrleeqftqy
Timeline for d6h24a_: