Lineage for d6h24b_ (6h24 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308452Species Sphinx1.76-related dna [TaxId:1515702] [368832] (1 PDB entry)
  8. 2308454Domain d6h24b_: 6h24 B: [368833]
    automated match to d1hkqa_

Details for d6h24b_

PDB Entry: 6h24 (more details), 1.53 Å

PDB Description: x-ray crystal structure of the msbi1.176 wh1 domain, a replication protein isolated from a multiple sclerosis patient
PDB Compounds: (B:) replication protein

SCOPe Domain Sequences for d6h24b_:

Sequence, based on SEQRES records: (download)

>d6h24b_ a.4.5.0 (B:) automated matches {Sphinx1.76-related dna [TaxId: 1515702]}
livkdnalmnasynlalveqrlillaiiearetgkginandpltvhassyinqfnverht
ayqalkdackdlfarqfsyqekrergrinitsrwvsqigymddtatveiifapavvplit
rleeqftqydieq

Sequence, based on observed residues (ATOM records): (download)

>d6h24b_ a.4.5.0 (B:) automated matches {Sphinx1.76-related dna [TaxId: 1515702]}
livkdnalmnasynlalveqrlillaiieareinandpltvhassyinqfnverhtayqa
lkdackdlfarqfsyqekrergrinitsrwvsqigymddtatveiifapavvplitrlee
qftqydieq

SCOPe Domain Coordinates for d6h24b_:

Click to download the PDB-style file with coordinates for d6h24b_.
(The format of our PDB-style files is described here.)

Timeline for d6h24b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6h24a_