SCOPe 2.07: Domain d6d58a2: 6d58 A:340-443

Lineage for d6d58a2 (6d58 A:340-443)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d6d58a2: 6d58 A:340-443 [368831]
   Other proteins in same PDB: d6d58a1, d6d58b1
   automated match to d4w4oa2
   complexed with bma, fuc, man, nag

Details for d6d58a2

PDB Entry: 6d58, 2.39 Å

PDB Description: crystal structure of a fc fragment of human igg3

PDB Compounds: (A:) Immunoglobulin heavy constant gamma 3

SCOPe Domain Sequences for d6d58a2:

Sequence; same for both SEQRES and ATOM records:

>d6d58a2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvsltclvkgfypsdiavewessgqpennynttppmld
sdgsfflyskltvdksrwqqgnifscsvmhealhnhftqkslsl

Timeline for d6d58a2:

• d6d58a2 is new in SCOPe 2.07-stable
  
• d6d58a2 appears in the current release, SCOPe 2.08