Lineage for d6d58a2 (6d58 A:340-443)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. Domain d6d58a2: 6d58 A:340-443 [368831]
    Other proteins in same PDB: d6d58a1, d6d58b1
    automated match to d4w4oa2

Details for d6d58a2

PDB Entry: 6d58 (more details), 2.3899999999999997 Å

PDB Description: crystal structure of a fc fragment of human igg3
PDB Compounds: (A:) Immunoglobulin heavy constant gamma 3

SCOPe Domain Sequences for d6d58a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d58a2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsreemtknqvsltclvkgfypsdiavewessgqpennynttppmld
sdgsfflyskltvdksrwqqgnifscsvmhealhnhftqkslsl

SCOPe Domain Coordinates for d6d58a2 are not available.

Timeline for d6d58a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6d58a1
View in 3D
Domains from other chains:
(mouse over for more information)
d6d58b1, d6d58b2