Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (13 species) not a true protein |
Species Salmonella typhimurium [TaxId:909946] [368797] (1 PDB entry) |
Domain d6d52a_: 6d52 A: [368822] automated match to d1eqwb_ complexed with cu, zn |
PDB Entry: 6d52 (more details), 1.6 Å
SCOPe Domain Sequences for d6d52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d52a_ b.1.8.1 (A:) automated matches {Salmonella typhimurium [TaxId: 909946]} entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls elkghslmihkggdnysdkpaplggggarfacgviek
Timeline for d6d52a_: