Lineage for d6d52b_ (6d52 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2374335Protein automated matches [190916] (13 species)
    not a true protein
  7. 2374375Species Salmonella typhimurium [TaxId:909946] [368797] (1 PDB entry)
  8. 2374377Domain d6d52b_: 6d52 B: [368819]
    automated match to d1eqwb_
    complexed with cu, zn

Details for d6d52b_

PDB Entry: 6d52 (more details), 1.6 Å

PDB Description: superoxide dismutase sodci of salmonella enterica serovar typhimurium at 1.6 angstrom resolution
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn] 1

SCOPe Domain Sequences for d6d52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d52b_ b.1.8.1 (B:) automated matches {Salmonella typhimurium [TaxId: 909946]}
entltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgm
kdgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlksls
elkghslmihkggdnysdkpaplggggarfacgvie

SCOPe Domain Coordinates for d6d52b_:

Click to download the PDB-style file with coordinates for d6d52b_.
(The format of our PDB-style files is described here.)

Timeline for d6d52b_: