Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d6d58b1: 6d58 B:237-339 [368808] Other proteins in same PDB: d6d58a2, d6d58b2 automated match to d4w4oa1 complexed with bma, fuc, man, nag |
PDB Entry: 6d58 (more details), 2.39 Å
SCOPe Domain Sequences for d6d58b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d58b1 b.1.1.2 (B:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqy nstfrvvsvltvlhqdwlngkeykckvsnkalpapiektiskt
Timeline for d6d58b1: