Lineage for d6dcua_ (6dcu A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (168 PDB entries)
    Uniprot P37231 232-505
  8. Domain d6dcua_: 6dcu A: [368795]
    automated match to d3prga_
    protein/DNA complex; complexed with nza

Details for d6dcua_

PDB Entry: 6dcu (more details), 2.9499999999999997 Å

PDB Description: crystal structure of ppar gamma co-crystallized with ntzdpa
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6dcua_:

Sequence, based on SEQRES records: (download)

>d6dcua_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpll

Sequence, based on observed residues (ATOM records): (download)

>d6dcua_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkiqsk
evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
ikktetdmslhpll

SCOPe Domain Coordinates for d6dcua_ are not available.

Timeline for d6dcua_:

Domains from other chains:
(mouse over for more information)
d6dcub_