SCOPe 2.08: Domain d6de9a1: 6de9 A:32-105

Lineage for d6de9a1 (6de9 A:32-105)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
   Fe-S binding region and beta cap

4. Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families)
   Pfam PF09360; PubMed 17766440

5. Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)

6. Protein automated matches [310858] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)

8. Domain d6de9a1: 6de9 A:32-105 [368794]
   Other proteins in same PDB: d6de9a2
   automated match to d3lpqa_
   complexed with fes, fun

Details for d6de9a1

PDB Entry: 6de9, 1.95 Å

PDB Description: mitoneet bound to furosemide

PDB Compounds: (A:) CDGSH iron-sulfur domain-containing protein 1

SCOPe Domain Sequences for d6de9a1:

Sequence; same for both SEQRES and ATOM records:

>d6de9a1 g.97.1.1 (A:32-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkhn
eetgdnvgpliikk

Timeline for d6de9a1:

• d6de9a1 first appeared in SCOPe 2.07