Lineage for d2wttj_ (2wtt J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714980Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2714981Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2715047Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2715048Protein automated matches [259190] (2 species)
    not a true protein
  7. 2715049Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)
  8. 2715081Domain d2wttj_: 2wtt J: [368791]
    automated match to d5hobg_

Details for d2wttj_

PDB Entry: 2wtt (more details), 2.3 Å

PDB Description: structure of the human p73 tetramerization domain (crystal form ii)
PDB Compounds: (J:) Tumor protein p73

SCOPe Domain Sequences for d2wttj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wttj_ a.53.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

SCOPe Domain Coordinates for d2wttj_:

Click to download the PDB-style file with coordinates for d2wttj_.
(The format of our PDB-style files is described here.)

Timeline for d2wttj_: