| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries) |
| Domain d5qp0a_: 5qp0 A: [368777] automated match to d5mp0d_ complexed with act, dms, edo, lf4 |
PDB Entry: 5qp0 (more details), 2 Å
SCOPe Domain Sequences for d5qp0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qp0a_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd
yickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpk
sklglapnkffmaipfirplrdwlsrrfg
Timeline for d5qp0a_: