Lineage for d5qora_ (5qor A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2578347Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2578348Protein automated matches [191036] (17 species)
    not a true protein
  7. 2578438Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries)
  8. 2578469Domain d5qora_: 5qor A: [368773]
    automated match to d5mp0d_
    complexed with act, dms, edo, ley

Details for d5qora_

PDB Entry: 5qor (more details), 1.95 Å

PDB Description: pandda analysis group deposition -- crystal structure of dcp2 (nudt20) in complex with z1203490773
PDB Compounds: (A:) dcp2 (nudt20)

SCOPe Domain Sequences for d5qora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qora_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd
yickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpk
sklglapnkffmaipfirplrdwlsrrfg

SCOPe Domain Coordinates for d5qora_:

Click to download the PDB-style file with coordinates for d5qora_.
(The format of our PDB-style files is described here.)

Timeline for d5qora_: