Lineage for d6r3va_ (6r3v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338321Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2338322Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2338323Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2338346Protein automated matches [334155] (2 species)
    not a true protein
  7. 2338360Species Human (Homo sapiens) [TaxId:9606] [334156] (3 PDB entries)
  8. 2338361Domain d6r3va_: 6r3v A: [368770]
    Other proteins in same PDB: d6r3vb_
    automated match to d1grnb_
    complexed with dtt, gdp, mes, mg, po4

Details for d6r3va_

PDB Entry: 6r3v (more details), 1.75 Å

PDB Description: crystal structure of rhoa-gdp-pi in complex with rhogap
PDB Compounds: (A:) Rho GTPase-activating protein 1

SCOPe Domain Sequences for d6r3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r3va_ a.116.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevq
qkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatl
qvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkain
pintftkflldhqgelfp

SCOPe Domain Coordinates for d6r3va_:

Click to download the PDB-style file with coordinates for d6r3va_.
(The format of our PDB-style files is described here.)

Timeline for d6r3va_: