SCOPe 2.07: Domain d6r3va_: 6r3v A:

Lineage for d6r3va_ (6r3v A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
   Pfam PF00620

6. Protein automated matches [334155] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [334156] (3 PDB entries)

8. Domain d6r3va_: 6r3v A: [368770]
   Other proteins in same PDB: d6r3vb_
   automated match to d1grnb_
   complexed with dtt, gdp, mes, mg, po4

Details for d6r3va_

PDB Entry: 6r3v, 1.75 Å

PDB Description: crystal structure of rhoa-gdp-pi in complex with rhogap

PDB Compounds: (A:) Rho GTPase-activating protein 1

SCOPe Domain Sequences for d6r3va_:

Sequence; same for both SEQRES and ATOM records:

>d6r3va_ a.116.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevq
qkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatl
qvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkain
pintftkflldhqgelfp

Timeline for d6r3va_:

• d6r3va_ is new in SCOPe 2.07-stable
  
• d6r3va_ appears in the current release, SCOPe 2.08