![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (950 PDB entries) |
![]() | Domain d6nz7l2: 6nz7 L:107-214 [368730] Other proteins in same PDB: d6nz7a_, d6nz7b_, d6nz7e_, d6nz7f_, d6nz7i1, d6nz7l1 automated match to d1dn0a2 complexed with nag |
PDB Entry: 6nz7 (more details), 2.95 Å
SCOPe Domain Sequences for d6nz7l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nz7l2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d6nz7l2: