Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Kallikrein 6 [74974] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74975] (17 PDB entries) |
Domain d6qfhb_: 6qfh B: [368728] automated match to d4d8na_ complexed with gol, j08 |
PDB Entry: 6qfh (more details), 1.65 Å
SCOPe Domain Sequences for d6qfhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qfhb_ b.47.1.2 (B:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl vcgdhlrglvswgdypcgskerpgvytnvcrytnwiqktiqa
Timeline for d6qfhb_: