Lineage for d6qfhb_ (6qfh B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein Kallikrein 6 [74974] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74975] (17 PDB entries) 
Domain d6qfhb_: 6qfh B: [368728]
automated match to d4d8na_
complexed with gol, j08
Details for d6qfhb_
PDB Entry: 6qfh (more details), 1.65 Å
PDB Description: crystal structure of human kallikrein 6 (n217d/i218y/k224r) in complex with gsk144.
PDB Compounds: (B:) Kallikrein-6SCOPe Domain Sequences for d6qfhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qfhb_ b.47.1.2 (B:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgdypcgskerpgvytnvcrytnwiqktiqa
SCOPe Domain Coordinates for d6qfhb_:
Click to download the PDB-style file with coordinates for d6qfhb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6qfhb_:
- d6qfhb_ first appeared in SCOPe 2.07
View in 3D
