Lineage for d6nz7f_ (6nz7 F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591606Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (14 PDB entries)
  8. 3068648Domain d6nz7f_: 6nz7 F: [368710]
    Other proteins in same PDB: d6nz7a_, d6nz7e_, d6nz7i1, d6nz7i2, d6nz7l1, d6nz7l2
    automated match to d5kanb_
    complexed with nag

Details for d6nz7f_

PDB Entry: 6nz7 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing influenza a antibody 429 b01 in complex with hemagglutinin hong kong 1968
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6nz7f_:

Sequence, based on SEQRES records: (download)

>d6nz7f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdea

Sequence, based on observed residues (ATOM records): (download)

>d6nz7f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrrqlren
aedmgngcfkiyhkcdnaciesirngtydhdvyrdea

SCOPe Domain Coordinates for d6nz7f_:

Click to download the PDB-style file with coordinates for d6nz7f_.
(The format of our PDB-style files is described here.)

Timeline for d6nz7f_: