Lineage for d6nnqb_ (6nnq B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (17 species)
    not a true protein
  7. 2502050Species Human (Homo sapiens) [TaxId:9606] [189560] (112 PDB entries)
  8. 3068629Domain d6nnqb_: 6nnq B: [368691]
    Other proteins in same PDB: d6nnqa1, d6nnqa2
    automated match to d2io1d_

Details for d6nnqb_

PDB Entry: 6nnq (more details), 2.62 Å

PDB Description: non-covalent structure of senp1 in complex with sumo2
PDB Compounds: (B:) Small ubiquitin-related modifier 3

SCOPe Domain Sequences for d6nnqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nnqb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtgg

SCOPe Domain Coordinates for d6nnqb_:

Click to download the PDB-style file with coordinates for d6nnqb_.
(The format of our PDB-style files is described here.)

Timeline for d6nnqb_:

  • d6nnqb_ is new in SCOPe 2.07-stable