Lineage for d6nz7i2 (6nz7 I:107-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (925 PDB entries)
  8. 3068627Domain d6nz7i2: 6nz7 I:107-214 [368689]
    Other proteins in same PDB: d6nz7a_, d6nz7b_, d6nz7e_, d6nz7f_, d6nz7i1, d6nz7l1
    automated match to d1dn0a2
    complexed with nag

Details for d6nz7i2

PDB Entry: 6nz7 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing influenza a antibody 429 b01 in complex with hemagglutinin hong kong 1968
PDB Compounds: (I:) 429 B01 FAB light chain

SCOPe Domain Sequences for d6nz7i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nz7i2 b.1.1.2 (I:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d6nz7i2:

Click to download the PDB-style file with coordinates for d6nz7i2.
(The format of our PDB-style files is described here.)

Timeline for d6nz7i2:

  • d6nz7i2 appears in periodic updates to SCOPe 2.07 starting on 2019-05-10