Lineage for d6njib_ (6nji B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342277Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2342278Species Human (Homo sapiens) [TaxId:9606] [89152] (53 PDB entries)
    Uniprot Q08499 388-713
  8. 3068591Domain d6njib_: 6nji B: [368653]
    automated match to d3iada_
    complexed with kr4, mg, zn

Details for d6njib_

PDB Entry: 6nji (more details), 2.45 Å

PDB Description: crystal structure of the pde4d catalytic domain and ucr2 regulatory helix with t-49
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d6njib_:

Sequence, based on SEQRES records: (download)

>d6njib_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstipqapappldeqnrdsqgnqvsefisntfld

Sequence, based on observed residues (ATOM records): (download)

>d6njib_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
daqdildtlednrewyqstipqnqvsefisntfld

SCOPe Domain Coordinates for d6njib_:

Click to download the PDB-style file with coordinates for d6njib_.
(The format of our PDB-style files is described here.)

Timeline for d6njib_:

  • d6njib_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-10