Lineage for d6nlfc_ (6nlf C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2313377Protein automated matches [190041] (30 species)
    not a true protein
  7. 2313780Species Pseudomonas aeruginosa [TaxId:287] [189215] (19 PDB entries)
  8. 3068557Domain d6nlfc_: 6nlf C: [368619]
    automated match to d4e6ka_
    complexed with k

Details for d6nlfc_

PDB Entry: 6nlf (more details), 1.45 Å

PDB Description: 1.45 a resolution structure of apo bfrb from pseudomonas aeruginosa
PDB Compounds: (C:) Ferroxidase

SCOPe Domain Sequences for d6nlfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nlfc_ a.25.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d6nlfc_:

Click to download the PDB-style file with coordinates for d6nlfc_.
(The format of our PDB-style files is described here.)

Timeline for d6nlfc_:

  • d6nlfc_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-10