Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (13 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries) Uniprot P02593 |
Domain d6muda_: 6mud A: [368607] automated match to d1iq5a_ complexed with ca |
PDB Entry: 6mud (more details), 2.69 Å
SCOPe Domain Sequences for d6muda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6muda_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee vdemireadidgdgqvnyeefvqmmta
Timeline for d6muda_: