Lineage for d6gwia_ (6gwi A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 3068480Species Halomonas elongata [TaxId:768066] [368542] (1 PDB entry)
  8. 3068540Domain d6gwia_: 6gwi A: [368602]
    automated match to d5ghfa_
    complexed with cl, edo, plp

Details for d6gwia_

PDB Entry: 6gwi (more details), 2 Å

PDB Description: the crystal structure of halomonas elongata amino-transferase
PDB Compounds: (A:) putrescine aminotransferase

SCOPe Domain Sequences for d6gwia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwia_ c.67.1.0 (A:) automated matches {Halomonas elongata [TaxId: 768066]}
qtqdyqaldrahhlhpftdfkalgeegsrvvthaegvyihdsegnrildgmaglwcvnlg
ygrrelveaataqleqlpyyntffktthppavrlaeklcdlapahinrvfftgsgseand
tvlrmvrrywalkgqpdkqwiigrenayhgstlagmslggmapmhaqggpcvpgiahirq
pywfgegrdmspeafgqtcaealeekilelgeekvaafiaepvqgaggaimppesywpav
kkvlakydillvadevicgfgrlgewfgsqhyglepdlmpiakglssgylpiggvlvgdr
vaetlieeggeffhgftysghptcaavalknlelleaegvvdrvrddlgpylaerwaslv
dhpivgearslglmgalelvadkttgqrfdkslgagnlcrdlcfanglvmrsvgdtmiis
pplvirreeidelvelarraldetarqlt

SCOPe Domain Coordinates for d6gwia_:

Click to download the PDB-style file with coordinates for d6gwia_.
(The format of our PDB-style files is described here.)

Timeline for d6gwia_:

  • d6gwia_ appears in periodic updates to SCOPe 2.07 starting on 2019-05-09