Lineage for d6hj7a_ (6hj7 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. Family a.77.1.0: automated matches [254238] (1 protein)
    not a true family
  6. Protein automated matches [254542] (3 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [255234] (2 PDB entries)
  8. Domain d6hj7a_: 6hj7 A: [368595]
    automated match to d2n97a_

Details for d6hj7a_

PDB Entry: 6hj7 (more details)

PDB Description: the nmr structure of nradd death domain
PDB Compounds: (A:) Death domain-containing membrane protein NRADD

SCOPe Domain Sequences for d6hj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hj7a_ a.77.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pdlgcqlylhipqqqqeevqrllmmgepakgwqelaghlgyqaeavetmacdqmpaytll
rnwaaqegnratlrvledalaaigredvvqvlsspaesssvv

SCOPe Domain Coordinates for d6hj7a_ are not available.

Timeline for d6hj7a_: