Lineage for d6i7ag_ (6i7a G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773294Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2773295Protein Speckle-type poz protein SPOP [141107] (1 species)
  7. 2773296Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries)
    Uniprot O43791 28-173
  8. 2773325Domain d6i7ag_: 6i7a G: [368580]
    automated match to d3hqma_

Details for d6i7ag_

PDB Entry: 6i7a (more details), 2.2 Å

PDB Description: co-crystal structure of human spop math domain (d140n) and human brd3 fragment
PDB Compounds: (G:) Speckle-type POZ protein

SCOPe Domain Sequences for d6i7ag_:

Sequence, based on SEQRES records: (download)

>d6i7ag_ b.8.1.1 (G:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrnflldean
gllpddkltlfcevsvvqd

Sequence, based on observed residues (ATOM records): (download)

>d6i7ag_ b.8.1.1 (G:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcremgeviksstfssgandklkwclrvnpkgldeeskdylslyl
llvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrnflldeang
llpddkltlfcevsvvqd

SCOPe Domain Coordinates for d6i7ag_:

Click to download the PDB-style file with coordinates for d6i7ag_.
(The format of our PDB-style files is described here.)

Timeline for d6i7ag_: