Class b: All beta proteins [48724] (180 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
Protein Speckle-type poz protein SPOP [141107] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries) Uniprot O43791 28-173 |
Domain d6i7ag_: 6i7a G: [368580] automated match to d3hqma_ |
PDB Entry: 6i7a (more details), 2.2 Å
SCOPe Domain Sequences for d6i7ag_:
Sequence, based on SEQRES records: (download)
>d6i7ag_ b.8.1.1 (G:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrnflldean gllpddkltlfcevsvvqd
>d6i7ag_ b.8.1.1 (G:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcremgeviksstfssgandklkwclrvnpkgldeeskdylslyl llvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrnflldeang llpddkltlfcevsvvqd
Timeline for d6i7ag_: