Lineage for d6hyna_ (6hyn A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540288Domain d6hyna_: 6hyn A: [368570]
    automated match to d3wanb_

Details for d6hyna_

PDB Entry: 6hyn (more details), 1.14 Å

PDB Description: structure of atg13 lir motif bound to gabarap
PDB Compounds: (A:) Autophagy-related protein 13,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d6hyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hyna_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddfvmidfkpafsgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
yiaysdesvygl

SCOPe Domain Coordinates for d6hyna_:

Click to download the PDB-style file with coordinates for d6hyna_.
(The format of our PDB-style files is described here.)

Timeline for d6hyna_: